Anti-SLC39A7 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human SLC39A7

Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.[supplied by OMIM].

Synthetic peptide located within the following region: HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

50 kDa

rabbit, pig, horse, dog, human

0.5 mg - 1 mg/mL

western blot: suitable

Q92504

wet ice

−20℃

human ... SLC39A7(7922)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3