Anti-SLCO1B3 antibody produced in rabbit

HPA004943    Human Protein Atlas characterization data

The organic anion transporting polypeptides (OATPS) are membrane bound transporters belonging to the SLC (solute carrier) superfamily. SLCO1B3 (solute carrier organic anion transporter family, member 1B3) or OATP1B3 is a drug transporter, which belongs to the OATP1B subfamily. It is expressed in hepatocytes at the basolateral membrane. SLCO1B3 gene has two major single nucleotide polymorphisms (SNP) at exon 3 and 6, and these polymorphic variations determine the characteristics of the transportations of various substrates. The gene is located in the chromosomal region 12p12.

Solute carrier organic anion transporter family member 1B3 recombinant protein epitope signature tag (PrEST)

Anti-SLCO1B3 antibody is suitable for immunocytochemistry.
Anti-SLCO1B3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

SLCO1B3 (solute carrier organic anion transporter family, member 1B3) plays a major role in the uptake and clearance of a broad range of drugs and drug metabolites in liver. SLCO1B3 is also responsible for the uptake of the cancer drugs- paclitaxel and docetaxel. It has been suggested that, in humans, ABCC3, OATP1B1, and SLCO1B3 form a liver- blood shuttle, where ABCC3 secretes the bilirubin glucoronide conjugates in the blood, which is then reabsorbed back to liver by OATP1B1 and SLCO1B3. Any deficiency in SLCO1B3 may therefore, be implicated in Rotor Syndrome or Rotor type hyperbilirubinemia. It mediates uptake of steroid hormones such as testosterone, and is found to be overexpressed in prostate cancer tissue as compared to normal tissue. SNPs in the gene SLCO1B3 determine the prognosis and survival in prostate cancer patients.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86073.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA

Q9NPD5

wet ice

−20℃

human ... SLCO1B3(28234)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1