Anti-SMARCA2 antibody produced in rabbit

MFCD05665220

NA.41

SWItch/Sucrose Non-Fermentable (SWI/SNF)-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 (SMARCA2) is a member of the SWI/SNF family of proteins and is highly like the Brahma protein of Drosophila. Two transcript variants encoding different isoforms have been found for this gene, which contains a trinucleotide repeat (CAG) length polymorphism.

Synthetic peptide directed towards the middle region of human SMARCA2

Rabbit Anti-SMARCA2 can be used for western blot applications at a concentration of 0.5 μg/ml. It can also be used for IHC applications at 4-8 μg/ml.

SMARCA2 protein is a part of the large adenosine triphosphate (ATP)-dependent chromatin remodeling complex SWItch/sucrose non-fermentable (SWI/SNF), which is required for transcriptional activation of genes normally repressed by chromatin. Members of SWI/SNF family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes.

Synthetic peptide located within the following region: VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

32 kDa

human, bovine, rat, mouse, guinea pig, rabbit, horse, dog

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_620614

P51531

wet ice

−20℃

human ... SMARCA2(6595)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3