Anti-SRPK2 antibody produced in rabbit

MFCD02264113

HPA015522    Human Protein Atlas characterization data

SRPK2 (serine/arginine- rich protein-specific kinase 2) belongs to the family of mitosis-regulated kinases called SRPK. This protein primarily resides in the cytoplasm, and contains bipartite kinase domains, which are separated by a spacer region. This protein has a molecular weight of 115kDa.

Serine/threonine-protein kinase SRPK2 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

SRPK2 (serine/arginine- rich protein-specific kinase 2) leads to elevated expression cyclin A1, by interacting with and binding acinus protein. This protein is a Ser/Arg (SR), which plays an essential role in the splicing of RNA. Phosphorylation of this protein by SRPK2 results in the movement of this protein to nucleoplasm from nucleus speckles. Acinus protein mediates cell growth and proliferation. The expression of both these proteins is up-regulated in human myeloid hematological malignancies. SRPK2 also phosphorylates Srp75, an SR protein, which results in elevated expression of human immunodeficiency virus (HIV). It phosphorylates the RS motif of BLRF2 protein of Epstein-Barr virus (EBV), which is essential for the replication of EBV. It is also essential for the replication of hepatitis C virus, and thus has potential as a therapeutic target for novel antiviral agents.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73485.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

recombinant expression
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

QQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPL

P78362

wet ice

−20℃

human ... SRPK2(6733)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)