Anti-TBX21 (AB1) antibody produced in rabbit

NA.41

T-box genes encode transcription factors that regulate developmental processes. T-box transcription factor 21 (TBX21) is the human ortholog of mouse Tbx21/Tbet, a lineage commitment regulator for the differentiation of interferon-gamma (IFNG) producting CD4 T helper (Th1) 1 cells.
TBX21 is a transcription factor that is involved in the development of T lymphocytes. Functional TBX21 variations have been associated with aspirin-induced asthma and clinical outcomes for inhaled corticosteroid therapy in asthma patients.
Rabbit polyclonal anti-TBX21 (AB1) antibody reacts with human, bovine, canine, and mouse T-box transcription factor 21 transcription factors.

Synthetic peptide directed towards the N terminal region of human TBX21

Rabbit polyclonal anti-TBX21 (AB1) antibody is used to tag T-box 21 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of T-box transcription factor 21 in the differentiation of interferon-gamma (IFNG) producting CD4 T helper 1 (Th1) cells.
Rabbit Anti-TBX21 (AB1) antibody can be used for western blot assays at a concentration of 2.5μg/ml.

TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Expression of the human TBX21 correlates w

Synthetic peptide located within the following region: FYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAG

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

58 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_037483

Q9UL17

wet ice

−20℃

human ... TBX21(30009)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3