Anti-UQCRFS1 antibody produced in rabbit

MFCD01633826

HPA041863    Human Protein Atlas characterization data

Ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1) gene is mapped to human chromosome 19q12. The encoded protein is mainly localized to inner membranes of mitochondria.

ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 recombinant protein epitope signature tag (PrEST)

Anti-UQCRFS1 antibody produced in rabbit has been used in western blot analysis.

Ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1) is a main component of cytochrome bc1 complex (complex III) in the mitochondria. It plays a vital role in redox reactions in the mitochondria as it is involved in electron transport. Elevated expression of UQCRFS1 is associated with the development of acute myeloid leukemia (ALL), ovarian cancer and breast cancer.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST82804.

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human, rat

antibody small pack of 25 μL

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV

P47985

wet ice

−20℃

human ... UQCRFS1(7386)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1