Anti-VHLL antibody produced in mouse

NA.41

Von Hippel-Lindau (VHL) tumor suppressor protein is a component of an E3 ubiquitin ligase complex that the selectively ubiquitinates the alpha subunit of the hypoxia-inducible factor (HIF) transcription factor for proteasome-mediated degradation. Inactivation of VHL causes VHL disease and sporadic kidney cancer. This gene encodes a VHL homolog that lacks one of two key domains necessary for VHL function. It binds HIF alpha but fails to recruit the E3 ubiquitin ligase complex, and therefore functions as a dominant-negative VHL and a protector of HIF alpha. This gene is intronless and predominantly expressed in the placenta, and may contribute to the regulation of oxygen homeostasis and neovascularization during placenta development. (provided by RefSeq)

VHLL (ADR83480.1, 1 a.a. ~ 139 a.a) full-length human protein.

Sequence
MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSRELSRIIICNHSPRIVLPVWLNYYGKLLPYLTLLPGRDFRIHNFRSHPWLFRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

buffered aqueous solution

antigen 15.3 kDa

human

western blot: 1 μg/mL

HQ258729.1

Q6RSH7

dry ice

−20℃

human ... VHLL(391104)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

13 - Non Combustible Solids

WGK 1