Anti-ZA20D1 antibody produced in rabbit

NA.41

OTU deubiquitinase 7B (OTUD7B or CEZANNE or ZA20D1) is a de-ubiquitinating enzyme that is known to affect actin structure. It has been implicated in the invasion of squamous cell carcinoma (SCC).
Rabbit Anti-ZA20D1 antibody recognizes human, mouse, rat, canine, and bovine ZA20D1.

Synthetic peptide directed towards the middle region of human ZA20D1

Rabbit Anti-ZA20D1 antibody can be used for western blot applications at a concentration of 1.25 μg/ml.

The ZA20D1 gene encodes an enzyme that cleaves ubiquitin from proteins. This gene has the ability to down-regulate NF-kappa B which plays a pivotal role in inflammatory processes through induction of adhesion molecules and chemokines.

Synthetic peptide located within the following region: WKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGK

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

94 kDa

mouse, pig, bovine, dog, rat, human

0.5 mg - 1 mg/mL

western blot: suitable

NP_064590

Q6GQQ9

wet ice

−20℃

human ... ZA20D1(56957)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3