Anti-ZDHHC17 (AB2) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human ZDHHC17

Anti-ZDHHC17 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

ZDHHC17 is a palmitoyl acyl transferase (PAT) expressed primarily in insulin-positive cells in islets of Langerhans. Overexpression of HIP14 is related to a reduction in IL-1beta-induced NF-kappaB activity as well as can protect against IL-1beta-mediated apoptosis. Additionally, it is a ClipR-59 palmitoyltransferase that modifies the ClipR-59 plasma membrane binding and hence regulates the Akt signaling as well as Glut4 membrane translocation in adipocytes. It also facilitates the Mg²⁺ transport.

Synthetic peptide located within the following region: FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

44 kDa

dog, human, rat, bovine, horse, guinea pig, rabbit, mouse

0.5 mg - 1 mg/mL

western blot: suitable

NP_056151

Q8IUH5

wet ice

−20℃

human ... ZDHHC17(23390)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3