Anti-ZDHHC6 antibody produced in rabbit

HPA014357    Human Protein Atlas characterization data

The gene ZDHHC6 (zinc finger DHHC-type containing 6) encodes a transmembrane enzyme containing a conserved cytosolic DHHC domain and is expressed mainly in the brain, uterus, kidney, lung, colon, thymus and small intestine. The gene is mapped to human chromosome 10q25.2 and contains nine exons.

Palmitoyltransferase ZDHHC6, probable recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

The gene ZDHHC6 (zinc finger DHHC-type containing 6), also referred to as DHHC-6, encodes a palmitoyltransferase that catalyzes the palmitoylation of calnexin on two juxtamembranous cysteines. It is localized to the ER (endoplasmic reticulum) and targets calnexin to the central ER. It is the only palmitoyltransferase involved in this process out of the 16 DHHC enzymes present in the mammalian ER. Overexpression of DHHC6 leads to increased palmitoylation of endogenous as well as ectopically expressed calnexin. Knock down of DHHC6 results in a change in cell morphology. Palmitoylation of calnexin controls the association of calnexin with the ribosome–translocon complex (RTC) forming a supercomplex. The formation of this supercomplex is necessary for the capture of proteins by chaperones outside the translocon and to initiate folding.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73147.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:500- 1:1000

QLYHRLSFGWNTVKIDMSAARRDPLPIVPFGLAAF

Q9H6R6

wet ice

−20℃

human ... ZDHHC6(64429)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)