Anti-HBEGF (N-terminal) antibody produced in rabbit

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

22 kDa

rat, pig, rabbit, canine, guinea pig, bovine, human, mouse

0.5 mg/mL

western blot: 1 μg/mL

NM_001945

wet ice

−20℃

human ... HBEGF(57396)

HBEGF is a growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. It is required for normal cardiac valve formation and normal heart function. HBEGF promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. It also acts as a diphtheria toxin receptor.

Synthetic peptide directed towards the N-terminal region of Human HBEGF

Synthetic peptide located within the following region: FLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKV

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

nwg