Anti-IL3RA (C-terminal) antibody produced in rabbit

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

41 kDa

human

0.5 mg/mL

western blot: 1 μg/mL

NM_002183

wet ice

−20℃

human ... IL3RA(57396)

The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y.

Synthetic peptide located within the following region: IQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRF

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

nwg