Anti-WDR7 (C-terminal) antibody produced in rabbit

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

163 kDa

bovine, mouse, rat, horse, human, guinea pig, rabbit, canine

0.5 mg/mL

western blot: 1 μg/mL

wet ice

−20℃

human ... WDR7(57396)

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) that may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. The encoded protein forms the beta subunit of rabconnectin-3 and binds directly with Rab3A GDP/GTP exchange protein and indirectly with Rab3A GDP/GTP activating protein; these proteins are regulators of Rab3 small G protein family members involved in control of the calcium-dependant exocytosis of neurotransmitters. Alternatively spliced transcript variants encoding different isoforms have been described.

Synthetic peptide directed towards the C-terminal region of Human WDR7

Synthetic peptide located within the following region: LYDIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSL

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

nwg