Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

100

mouse

purified antibody

primary antibodies

HO-1-1, monoclonal

liquid

≤0.1% sodium azide as preservative

monkey, human, bovine, rat, mouse, canine

Calbiochem^®

OK to freeze
avoid repeated freeze/thaw cycles

IgG1

wet ice

−20℃

200 μg in Plastic ampoule
Please refer to vial label for lot-specific concentration.

Recognizes the ~32 kDa HO-1 protein.
Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.
Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.

a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
Human

Immunoblotting (4 µg/ml, chemiluminescence)

Immunocytochemistry (1:1000)

Immunoprecipitation (20 µg/ml)

Toxicity: Standard Handling (A)

In PBS, 50% glycerol.

Following initial thaw, aliquot and freeze (-20°C).

Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J.2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

10 - Combustible liquids

WGK 1