SILu^TMMAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody

200

expressed in CHO cells

primary antibodies

≥90% (SDS-PAGE)

vial of 100 μg

wet ice

−20℃

SILu^™ MAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody is a recombinant, stable isotope labeled, monoclonal antibody which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in CHO cells, SILuMAb Adalimumab is designed to be used as an internal standard for analysis of Adalimumab in human serum. Each vial of SILuMAb Adalimumab contains the labeled antibody lyophilized from a solution of phosphate buffered saline. Vial content was determined by measuring A₂₈₀ and using an extinction coefficient (E^0.1%) of 1.4.
SILu^™ MAb Adalimumab is for R&D use only. Not for drug, household, or other uses.

SILu^™Mab Adalimumab Heavy Chain: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGR
FTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILu^™Mab Adalimumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Poster: Multiplex Quantification of Infliximab and Adalimumab in Human Serum by LC-MS/MS Using Full-Length Stable Isotope Labeled Internal Standards

Adalimumab-Specific Peptide Sequences Liberated from SILuMAb Adalimumab by Tryptic Digest

Universal Peptide Sequence Location
GLEWVSAITWNSGHIDYADSVEGRHeavy chain
APYTFGQGTKLight chain
FSGSGSGTDFTLTISSLQPEDVATYYCQRLight chain

Produced utilizing enriched media containing stable isotope labeled amino acids are ¹³C₆, ¹⁵N₄-labeled Arginine and ¹³C₆, ¹⁵N₂-labeled Lysine.
SILu^™Mab Adalimumab is designed to be used as a internal standard for analysis of Adalimumab in human serum.

SILu^™Mab Adalimumab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.

• Briefly centrifuge the vial at ~10,000 × g to collect the product at the bottom of the vial.
• Add 500 μL of ultrapure water containing 0.1% formic acid to the vial.
• Mix the contents by gently inverting the vial a minimum of 5 times.
• Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.

Each vial of SILu^™Mab Adalimumab contains the labeled antibody in a lyophilized form containing phosphate buffered saline.

Quantitative
MRM settings provided (xls)

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of sigma-aldrich Co. LLC

13 - Non Combustible Solids

WGK 3